PDB entry 5e13

View 5e13 on RCSB PDB site
Description: Crystal structure of Eosinophil-derived neurotoxin in complex with the triazole double-headed ribonucleoside 11c
Class: hydrolase
Keywords: hydrolase, nuclease
Deposited on 2015-09-29, released 2015-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-secretory ribonuclease
    Species: Homo sapiens [TaxId:9606]
    Gene: RNASE2, EDN, RNS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10153 (Start-160)
      • conflict (26)
    Domains in SCOPe 2.05: d5e13a_
  • Heterogens: 5J9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e13A (A:)
    mvpklftsqiclllllgllavegslhmkppqftwaqwfetqhinmtsqqctnamqvinny
    qrrcknqntfllttfanvvnvcgnpnmtcpsnktrknchhsgsqvplihcnlttpspqni
    sncryaqtpanmfyivacdnrdqrrdppqypvvpvhldrii
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e13A (A:)
    mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
    mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
    ppqypvvpvhldrii