PDB entry 5e0m

View 5e0m on RCSB PDB site
Description: LC8 - Chica (468-476) Complex
Class: transport protein
Keywords: Complex, Dynein, TRANSPORT PROTEIN
Deposited on 2015-09-29, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0ma_
  • Chain 'C':
    Compound: Protein Chica peptide
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E0M (Start-12)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5e0mA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg

    Sequence, based on observed residues (ATOM records): (download) 
    >5e0mA (A:)
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg

  • Chain 'C':
    No sequence available.