PDB entry 5e0l

View 5e0l on RCSB PDB site
Description: LC8 - Chica (415-424) Complex
Class: transport protein
Keywords: Complex, Dynein, TRANSPORT PROTEIN
Deposited on 2015-09-29, released 2015-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5e0la_
  • Chain 'C':
    Compound: Protein Chica peptide
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E0L (Start-13)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e0lA (A:)
    msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
    nfgsyvthetrhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0lA (A:)
    drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
    gsyvthetrhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.