PDB entry 5e0l
View 5e0l on RCSB PDB site
Description: LC8 - Chica (415-424) Complex
Class: transport protein
Keywords: Complex, Dynein, TRANSPORT PROTEIN
Deposited on
2015-09-29, released
2015-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-22, with a file datestamp of
2017-11-17.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 1, cytoplasmic
Species: Drosophila melanogaster [TaxId:7227]
Gene: CTP, CDLC1, DDLC1, CG6998
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5e0la_ - Chain 'C':
Compound: Protein Chica peptide
Species: Drosophila melanogaster [TaxId:7227]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5e0lA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>5e0lA (A:)
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg
- Chain 'C':
No sequence available.