PDB entry 5e0k

View 5e0k on RCSB PDB site
Description: X-ray crystal structure of tryptophan synthase complex from Pyrococcus furiosus at 2.76 A
Class: lyase
Keywords: Complex, PLP, Lyase, Enzyme
Deposited on 2015-09-29, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0ka_
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kb_
  • Chain 'C':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kd_
  • Chain 'E':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0ke_
  • Chain 'F':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kf_
  • Chain 'G':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kg_
  • Chain 'H':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kh_
  • Chain 'I':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0ki_
  • Chain 'J':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kj_
  • Chain 'K':
    Compound: tryptophan synthase alpha chain
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpA, PF1705
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kk_
  • Chain 'L':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: trpB1, PF1706
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e0kl_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e0kA (A:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kA (A:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeeipktaydllrra
    kricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveell
    gi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e0kB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e0kC (C:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kC (C:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeipktaydllrrak
    ricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellg
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e0kD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5e0kE (E:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kE (E:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeeipktaydllrra
    kricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveell
    g
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5e0kF (F:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kF (F:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5e0kG (G:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kG (G:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeipktaydllrrak
    ricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellg
    i
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5e0kH (H:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kH (H:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5e0kI (I:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kI (I:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeeipktaydllrra
    kricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveell
    gi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5e0kJ (J:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kJ (J:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5e0kK (K:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay
    dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk
    kveellgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kK (K:)
    mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk
    ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf
    hakefteiareegiktvflaapntpderlkviddmttgfvylvsleipktaydllrrakr
    icrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellgi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5e0kL (L:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e0kL (L:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvs