PDB entry 5dzs

View 5dzs on RCSB PDB site
Description: 1.5 Angstrom Crystal Structure of Shikimate Dehydrogenase 1 from Peptoclostridium difficile.
Class: oxidoreductase
Keywords: shikimate dehydrogenase 1, CSGID, Structural genomics, Center for Structural Genomics of Infectious Diseases, OXIDOREDUCTASE
Deposited on 2015-09-26, released 2015-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase (NADP(+))
    Species: Peptoclostridium difficile (strain 630) [TaxId:272563]
    Gene: aroE1, CD630_18370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q187E7 (0-268)
      • expression tag (269)
    Domains in SCOPe 2.06: d5dzsa1, d5dzsa2, d5dzsa3
  • Chain 'B':
    Compound: Shikimate dehydrogenase (NADP(+))
    Species: Peptoclostridium difficile (strain 630) [TaxId:272563]
    Gene: aroE1, CD630_18370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q187E7 (0-268)
      • expression tag (269)
    Domains in SCOPe 2.06: d5dzsb1, d5dzsb2, d5dzsb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dzsA (A:)
    mnffglvgeklshsvspqihkrvfeilniesayknfeiskediskldgaikllgiqgvnv
    tvpykerimkyldfispeakrigavntillrenmlygyntdyfgldsmfkmanidvqgkv
    avilgtggaskaaltyfidsgieklyvstrkkddkkllnskailidyeelkhikgdiiln
    atpvgmypnvgispvsksiiqnfdilidliynpgeteflrignsmgkktcdglymlvgqa
    iksqeiwqdtkidnsildviynelkleflgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dzsA (A:)
    mnffglvgeklshsvspqihkrvfeilniesayknfeiskediskldgaikllgiqgvnv
    tvpykerimkyldfispeakrigavntillrenmlygyntdyfgldsmfkmanidvqgkv
    avilgtggaskaaltyfidsgieklyvstrkkskailidyeelkhikgdiilnatpvgmy
    pnvgispvsksiiqnfdilidliynpgeteflrignsmgkktcdglymlvgqaiksqeiw
    qdtkidnsildviynelkleflg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dzsB (B:)
    mnffglvgeklshsvspqihkrvfeilniesayknfeiskediskldgaikllgiqgvnv
    tvpykerimkyldfispeakrigavntillrenmlygyntdyfgldsmfkmanidvqgkv
    avilgtggaskaaltyfidsgieklyvstrkkddkkllnskailidyeelkhikgdiiln
    atpvgmypnvgispvsksiiqnfdilidliynpgeteflrignsmgkktcdglymlvgqa
    iksqeiwqdtkidnsildviynelkleflgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dzsB (B:)
    mnffglvgeklshsvspqihkrvfeilniesayknfeiskediskldgaikllgiqgvnv
    tvpykerimkyldfispeakrigavntillrenmlygyntdyfgldsmfkmanidvqgkv
    avilgtggaskaaltyfidsgieklyvstrkkddkkllnskailidyeelkhikgdiiln
    atpvgmypnvgispvsksiiqnfdilidliynpgeteflrignsmgkktcdglymlvgqa
    iksqeiwqdtkidnsildviynelkleflg