PDB entry 5dzn

View 5dzn on RCSB PDB site
Description: human T-cell immunoglobulin and mucin domain protein 4
Class: immune system
Keywords: receptor, Ig V domain, IMMUNE SYSTEM
Deposited on 2015-09-25, released 2015-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dzna1, d5dzna2
  • Chain 'B':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dznb1, d5dznb2
  • Chain 'C':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dznc1, d5dznc2
  • Chain 'D':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dznd1, d5dznd2
  • Chain 'E':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dzne1, d5dzne2
  • Chain 'F':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dznf1, d5dznf2
  • Chain 'G':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dzng_
  • Chain 'H':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96H15 (1-113)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5dznh1, d5dznh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznA (A:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznB (B:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznC (C:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznD (D:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznE (E:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznF (F:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >5dznG (G:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

    Sequence, based on observed residues (ATOM records): (download) 
    >5dznG (G:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqr

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dznH (H:)
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra