PDB entry 5dyg

View 5dyg on RCSB PDB site
Description: Structure of p97 N-D1 L198W mutant in complex with ADP
Class: hydrolase
Keywords: VCP, AAA ATPase, hydrolase
Deposited on 2015-09-24, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55072 (Start-459)
      • engineered mutation (197)
    Domains in SCOPe 2.07: d5dyga1, d5dyga2, d5dyga3
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dygA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeswnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dygA (A:)
    ailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsd
    dtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevy
    lkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikrede
    eeswnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktli
    aravanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkre
    kthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipda
    tgrleilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidled
    etidaevmnslavtmddfrwalsqsn