PDB entry 5dy4

View 5dy4 on RCSB PDB site
Description: Crystal structure of human Sirt2 in complex with a brominated 2nd generation SirReal inhibitor and NAD+
Class: hydrolase
Keywords: Hydrolase, hydrolase inhibitor complex
Deposited on 2015-09-24, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent protein deacetylase sirtuin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT2, SIR2L, SIR2L2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IXJ6 (3-303)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5dy4a1, d5dy4a2
  • Heterogens: ZN, 5GN, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dy4A (A:)
    ghmerlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhl
    pypeaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtl
    eriagleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdi
    vffgeslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagq
    sdpflgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasi
    daqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dy4A (A:)
    ghmerlldeltlegvarymqsercrrviclvgagistsagipdfrsglydnlekyhlpyp
    eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
    agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
    geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
    flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
    s