PDB entry 5dxx

View 5dxx on RCSB PDB site
Description: Crystal structure of Dbr2
Class: oxidoreductase
Keywords: Dbr2, OXIDOREDUCTASE
Deposited on 2015-09-24, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Artemisinic aldehyde Delta(11(13)) reductase
    Species: Artemisia annua [TaxId:35608]
    Gene: DBR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dxxa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dxxA (A:)
    msekptlfsaykmgkfnlshrvvlapmtrcrainaipnealveyyrqrstaggflitegt
    mispssagfphvpgiftkeqvegwkkvvdaahkegavifcqlwhvgrashqvyqpggaap
    isstskpiskkweillpdatygtypeprplaaneilevvedyrvaainaieagfdgieih
    gahgylldqfmkdgindrtdeyggslenrckfilqvvqavsaaigtdrvgirispaidht
    damdsdprslglavierlnklqfklgsrlaylhvtqprytadghgqteagangseeevaq
    lmktwrgayvgtficcggytrelglqavaqgdadlvafgryfvsnpdlvlrlklnaplnr
    ydratfythdpvvgytdypsldkgsll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dxxA (A:)
    kptlfsaykmgkfnlshrvvlapmtrcrainaipnealveyyrqrstaggflitegtmis
    pssagfphvpgiftkeqvegwkkvvdaahkegavifcqlwhvgrashqvyqpggaapiss
    tskpiskkweillpdatygtypeprplaaneilevvedyrvaainaieagfdgieihgah
    gylldqfmkdgindrtdeyggslenrckfilqvvqavsaaigtdrvgirispaidhtdam
    dsdprslglavierlnklqfklgsrlaylhvtqprytadghgqteeeevaqlmktwrgay
    vgtficcggytrelglqavaqgdadlvafgryfvsnpdlvlrlklnaplnrydratfyth
    dpvvgytdypsldkgsl