PDB entry 5dxu

View 5dxu on RCSB PDB site
Description: p110delta/p85alpha with GDC-0326
Class: Transferase/Inhibitor
Keywords: lipid kinase, inhibitor, Transferase-Inhibitor complex
Deposited on 2015-09-23, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  Species: Homo sapiens [TaxId:9606]
  Gene: Pik3cd
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00329
• Chain 'B':
  Compound: Phosphatidylinositol 3-kinase regulatory subunit alpha
  Species: Bos taurus [TaxId:9913]
  Gene: PIK3R1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23727 (0-168)
  Domains in SCOPe 2.07: d5dxub_
• Heterogens: 5H5, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dxuB (B:)
  yqqdqvvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnet
  ikifeeqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlk
  kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg