PDB entry 5dxd

View 5dxd on RCSB PDB site
Description: Crystal structure of Putative beta-glucanase (Rv0315 ortholog) from Mycobacterium abscessus
Class: hydrolase
Keywords: SSGCID, Mycobacterium, Mycobacterium abscessus, Putative beta-glucanase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2015-09-23, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative beta-glucanase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_1840c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dxda_
  • Chain 'B':
    Compound: Putative beta-glucanase
    Species: Mycobacterium abscessus [TaxId:561007]
    Gene: MAB_1840c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dxdb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dxdA (A:)
    mahhhhhhadrvhppaappdaqssgfvfrdefdgpagsapdgskwvaakfreriknpvfw
    drpenmgeyrdsrtnifldgnsnlviratkegnkyfsgklhgtfrggmghtfearikfnc
    ltdgcwpawwllndnperggeidmaewygnrdwpsgttvharldgtsfetlpvpidsnwh
    twrctwteaglyfwmdyhdgmepyltvdanslddwpfndpgytlqpmlnlavagsgggdp
    aggsypaemlvdyvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dxdA (A:)
    gfvfrdefdgpagsapdgskwvaakfreriknpvfwdrpenmgeyrdsrtnifldgnsnl
    viratkegnkyfsgklhgtfrggmghtfearikfncltdgcwpawwllndnperggeidm
    aewygnrdwpsgttvharldgtsfetlpvpidsnwhtwrctwteaglyfwmdyhdgmepy
    ltvdanslddwpfndpgytlqpmlnlavagsgggdpaggsypaemlvdyvrvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dxdB (B:)
    mahhhhhhadrvhppaappdaqssgfvfrdefdgpagsapdgskwvaakfreriknpvfw
    drpenmgeyrdsrtnifldgnsnlviratkegnkyfsgklhgtfrggmghtfearikfnc
    ltdgcwpawwllndnperggeidmaewygnrdwpsgttvharldgtsfetlpvpidsnwh
    twrctwteaglyfwmdyhdgmepyltvdanslddwpfndpgytlqpmlnlavagsgggdp
    aggsypaemlvdyvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dxdB (B:)
    gfvfrdefdgpagsapdgskwvaakfreriknpvfwdrpenmgeyrdsrtnifldgnsnl
    viratkegnkyfsgklhgtfrggmghtfearikfncltdgcwpawwllndnperggeidm
    aewygnrdwpsgttvharldgtsfetlpvpidsnwhtwrctwteaglyfwmdyhdgmepy
    ltvdanslddwpfndpgytlqpmlnlavagsgggdpaggsypaemlvdyvrvw