PDB entry 5dx5

View 5dx5 on RCSB PDB site
Description: Crystal structure of methionine gamma-lyase from Clostridium sporogenes
Class: lyase
Keywords: methionine gamma-lyase, lyase, Clostridium sporogenes
Deposited on 2015-09-23, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Clostridium sporogenes [TaxId:1509]
    Gene: megL, CLOSPO_00030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dx5a_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: Clostridium sporogenes [TaxId:1509]
    Gene: megL, CLOSPO_00030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dx5b_
  • Heterogens: PLP, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dx5A (A:)
    menikkmgfatkaihgghigdkqfgslatpiyqtstfifdsaeqggrrfageesgyiysr
    lgnptstevenklalleggeaavvaasgmgaiaaslwsalksgdhvvasdtlygctfall
    nhgltrygvevtfvdvsnldevknalkpntkvvyletpanptlkvtdirkisnmvhesnk
    ecfvfvdntfctpyiqrplelgadvvvhsatkylnghgdviagfavgkeefinqvklfgi
    kdmtgsvtgpfesfliirgmktlqlrmekhcknamevakfleshpavekvyypglesfky
    yqlareqmklpgamisfelkggveegkivmnnvklatlavslgdsetliqhpasmthspy
    taeerkaagisdglvrlsvgledaediiddlkqaldlivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dx5A (A:)
    enikkmgfatkaihgghigdkqfgslatpiyqtstfifdsaeqggrrfageesgyiysrl
    gnptstevenklalleggeaavvaasgmgaiaaslwsalksgdhvvasdtlygctfalln
    hgltrygvevtfvdvsnldevknalkpntkvvyletpanptlkvtdirkisnmvhesnke
    cfvfvdntfctpyiqrplelgadvvvhsatkylnghgdviagfavgkeefinqvklfgik
    dmtgsvtgpfesfliirgmktlqlrmekhcknamevakfleshpavekvyypglesfkyy
    qlareqmklpgamisfelkggveegkivmnnvklatlavslgdsetliqhpasmthspyt
    aeerkaagisdglvrlsvgledaediiddlkqaldlivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dx5B (B:)
    menikkmgfatkaihgghigdkqfgslatpiyqtstfifdsaeqggrrfageesgyiysr
    lgnptstevenklalleggeaavvaasgmgaiaaslwsalksgdhvvasdtlygctfall
    nhgltrygvevtfvdvsnldevknalkpntkvvyletpanptlkvtdirkisnmvhesnk
    ecfvfvdntfctpyiqrplelgadvvvhsatkylnghgdviagfavgkeefinqvklfgi
    kdmtgsvtgpfesfliirgmktlqlrmekhcknamevakfleshpavekvyypglesfky
    yqlareqmklpgamisfelkggveegkivmnnvklatlavslgdsetliqhpasmthspy
    taeerkaagisdglvrlsvgledaediiddlkqaldlivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dx5B (B:)
    enikkmgfatkaihgghigdkqfgslatpiyqtstfifdsaeqggrrfageesgyiysrl
    gnptstevenklalleggeaavvaasgmgaiaaslwsalksgdhvvasdtlygctfalln
    hgltrygvevtfvdvsnldevknalkpntkvvyletpanptlkvtdirkisnmvhesnke
    cfvfvdntfctpyiqrplelgadvvvhsatkylnghgdviagfavgkeefinqvklfgik
    dmtgsvtgpfesfliirgmktlqlrmekhcknamevakfleshpavekvyypglesfkyy
    qlareqmklpgamisfelkggveegkivmnnvklatlavslgdsetliqhpasmthspyt
    aeerkaagisdglvrlsvgledaediiddlkqaldliv