PDB entry 5dwp

View 5dwp on RCSB PDB site
Description: Crystal Structure of human transthyretin (TTR) processed with the CrystalDirect automated mounting and cryo-cooling technology
Class: transferase
Keywords: transthyretin, transferase
Deposited on 2015-09-22, released 2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dwpa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dwpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dwpA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dwpB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp