PDB entry 5dvx

View 5dvx on RCSB PDB site
Description: Crystal structure of the catalytic-domain of human carbonic anhydrase IX at 1.6 angstrom resolution
Class: lyase
Keywords: carbonic anhydrase IX, catalytic domain, water network, LYASE
Deposited on 2015-09-21, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790 (0-259)
      • engineered mutation (34)
      • engineered mutation (43)
      • engineered mutation (73)
      • engineered mutation (118-119)
      • engineered mutation (210)
    Domains in SCOPe 2.06: d5dvxa_
  • Chain 'B':
    Compound: Carbonic anhydrase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CA9, G250, MN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16790
      • engineered mutation (34)
      • engineered mutation (43)
      • engineered mutation (73)
      • engineered mutation (118-119)
      • engineered mutation (210)
    Domains in SCOPe 2.06: d5dvxb_
  • Heterogens: ZN, GOL, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dvxA (A:)
    hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
    hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
    arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
    dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
    plngrvieasfpagvdsspr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dvxB (B:)
    hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
    hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
    arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
    dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
    plngrvieasfpagvdsspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvxB (B:)
    wryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnngh
    svqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstkya
    rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
    fsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratqp
    lngrvieasfpagvd