PDB entry 5dvo

View 5dvo on RCSB PDB site
Description: Fc K392D/K409D homodimer
Class: immune system
Keywords: head-to-tail homodimer, Immunoglobulin, Fc, IMMUNE SYSTEM
Deposited on 2015-09-21, released 2016-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (171)
      • engineered mutation (188)
    Domains in SCOPe 2.06: d5dvoa1, d5dvoa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (171)
      • engineered mutation (188)
    Domains in SCOPe 2.06: d5dvob1, d5dvob2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dvoA (A:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennydttppvlds
    dgsfflysdltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvoA (A:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrk
    nqvsltclvkgfypsdiavewesngqpennydttppvldsdgsfflysdltvdksrwqqg
    nvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dvoB (B:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennydttppvlds
    dgsfflysdltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dvoB (B:)
    llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrk
    nqvsltclvkgfypsdiavewesngqpennydttppvldsdgsfflysdltvdksrwqqg
    nvfscsvmhealhnhytqkslslsp