PDB entry 5duw

View 5duw on RCSB PDB site
Description: Crystal structure of the human galectin-4 N-terminal carbohydrate recognition domain in complex with lactose-3'-sulfate
Class: sugar binding protein
Keywords: galectin-4, lectin, sulfate, sugar-binding protein, SUGAR BINDING PROTEIN
Deposited on 2015-09-21, released 2016-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5duwa_
  • Chain 'B':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5duwb_
  • Chain 'C':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5duwc_
  • Chain 'D':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5duwd_
  • Heterogens: 5GO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5duwA (A:)
    mayvpapgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdv
    afhfnprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnp
    fyeyghrlplqmvthlqvdgdlqlqsinfiggqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5duwA (A:)
    ptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhfnprfdgwdkv
    vfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyeyghrlplqmvt
    hlqvdgdlqlqsinfigg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5duwB (B:)
    mayvpapgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdv
    afhfnprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnp
    fyeyghrlplqmvthlqvdgdlqlqsinfiggqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5duwB (B:)
    ptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhfnprfdgwdkv
    vfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyeyghrlplqmvt
    hlqvdgdlqlqsinfiggq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5duwC (C:)
    mayvpapgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdv
    afhfnprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnp
    fyeyghrlplqmvthlqvdgdlqlqsinfiggqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5duwC (C:)
    ptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhfnprfdgwdkv
    vfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyeyghrlplqmvt
    hlqvdgdlqlqsinfig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5duwD (D:)
    mayvpapgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdv
    afhfnprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnp
    fyeyghrlplqmvthlqvdgdlqlqsinfiggqpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5duwD (D:)
    ptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhfnprfdgwdkv
    vfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyeyghrlplqmvt
    hlqvdgdlqlqsinfig