PDB entry 5duf

View 5duf on RCSB PDB site
Description: Crystal structure of M. tuberculosis EchA6 bound to ligand GSK729A
Class: lipid binding protein
Keywords: enoyl-CoA hydratase-like, lyase, lipid binding protein
Deposited on 2015-09-18, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MTCY31.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNP1 (20-262)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d5dufa1, d5dufa2
  • Heterogens: G7A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dufA (A:)
    mgsshhhhhhssglvprgshmigitqaeavltielqrperrnalnsqlveeltqairkag
    dgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaiga
    glqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaekltae
    ialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkaw
    gsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dufA (A:)
    shmigitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafca
    gadlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaf
    fqfptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaq
    awaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrpp
    kfqga