PDB entry 5du8

View 5du8 on RCSB PDB site
Description: Crystal structure of M. tuberculosis EchA6 bound to GSK572A
Class: lipid binding protein
Keywords: lyase, enoyl-CoA hydratase-like, lipid binding protein
Deposited on 2015-09-18, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MTCY31.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNP1 (20-262)
      • expression tag (19)
    Domains in SCOPe 2.07: d5du8a1, d5du8a2
  • Chain 'B':
    Compound: Probable enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MTCY31.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNP1 (20-262)
      • expression tag (19)
    Domains in SCOPe 2.07: d5du8b1, d5du8b2
  • Chain 'C':
    Compound: Probable enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MTCY31.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNP1 (20-262)
      • expression tag (19)
    Domains in SCOPe 2.07: d5du8c1, d5du8c2
  • Heterogens: 5FK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5du8A (A:)
    mgsshhhhhhssglvprgshmigitqaeavltielqrperrnalnsqlveeltqairkag
    dgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaiga
    glqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaekltae
    ialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkaw
    gsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5du8A (A:)
    hmigitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcag
    adpdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfptskygla
    ldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaaeiarlap
    laiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5du8B (B:)
    mgsshhhhhhssglvprgshmigitqaeavltielqrperrnalnsqlveeltqairkag
    dgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaiga
    glqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaekltae
    ialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkaw
    gsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5du8B (B:)
    hmigitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcag
    adlsfaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffqfp
    tskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqawaa
    eiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkfqg
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5du8C (C:)
    mgsshhhhhhssglvprgshmigitqaeavltielqrperrnalnsqlveeltqairkag
    dgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaiga
    glqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaekltae
    ialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkaw
    gsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5du8C (C:)
    hmigitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcag
    adlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaff
    qfptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqa
    waaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppk
    fqga