PDB entry 5du4

View 5du4 on RCSB PDB site
Description: Crystal structure of M. tuberculosis EchA6 bound to ligand GSK366A
Class: lipid binding protein
Keywords: enoyl-CoA hydratase-like, Lyase, LIPID BINDING PROTEIN
Deposited on 2015-09-18, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable enoyl-CoA hydratase echA6
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA6, Rv0905, MTCY31.33
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WNP1 (20-262)
      • expression tag (19)
    Domains in SCOPe 2.07: d5du4a1, d5du4a2
  • Heterogens: 5FF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5du4A (A:)
    mgsshhhhhhssglvprgshmigitqaeavltielqrperrnalnsqlveeltqairkag
    dgsaraivltgqgtafcagadlsgdafaadypdrlielhkamdaspmpvvgaingpaiga
    glqlamqcdlrvvapdaffqfptskyglaldnwsirrlsslvghgraramllsaekltae
    ialhtgmanrigtladaqawaaeiarlaplaiqhakrvlnddgaieeawpahkelfdkaw
    gsqdvieaqvarmekrppkfqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5du4A (A:)
    hmigitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcag
    adlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaff
    qfptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqa
    waaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppk
    fqga