PDB entry 5dtl

View 5dtl on RCSB PDB site
Description: Crystal structure of mEos2-A69T fluorescent protein
Class: fluorescent protein
Keywords: fluorescent protein, mEos2, blinking
Deposited on 2015-09-18, released 2015-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtla_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtld_
  • Chain 'E':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtle_
  • Chain 'F':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlf_
  • Chain 'G':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlg_
  • Chain 'H':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlh_
  • Chain 'I':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtli_
  • Chain 'J':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlj_
  • Chain 'K':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtlk_
  • Chain 'L':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (63)
      • engineered mutation (68-69)
      • engineered mutation (73)
      • engineered mutation (120)
      • engineered mutation (122)
      • engineered mutation (157)
    Domains in SCOPe 2.06: d5dtll_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dtlA (A:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlA (A:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dtlB (B:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlB (B:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dtlC (C:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlC (C:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dtlD (D:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlD (D:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5dtlE (E:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlE (E:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5dtlF (F:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlF (F:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5dtlG (G:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlG (G:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5dtlH (H:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlH (H:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5dtlI (I:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlI (I:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5dtlJ (J:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlJ (J:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5dtlK (K:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlK (K:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5dtlL (L:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    ygtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dtlL (L:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn