PDB entry 5dt7

View 5dt7 on RCSB PDB site
Description: Crystal structure of the GH1 beta-glucosidase from Exiguobacterium antarcticum B7 in space group C2221
Class: hydrolase
Keywords: GH1 family, beta-glucosidase, cold-active, tetramer, HYDROLASE
Deposited on 2015-09-17, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: bglA, Eab7_0297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dt7a_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: bglA, Eab7_0297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dt7b_
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: bglA, Eab7_0297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dt7c_
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: Exiguobacterium antarcticum (strain B7) [TaxId:1087448]
    Gene: bglA, Eab7_0297
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dt7d_
  • Heterogens: CXS, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dt7A (A:)
    mgsshhhhhhssglvprgshmasmkfapnfvfgtatssyqiegahdeggrtpsiwdtfcd
    tdgkvfekhngdvacdhyhrfeediqhikqlgvdtyrfsiawprifpskgqfnpegmafy
    ktlatrlqeegikpavtlyhwdlpmwaheeggwvnrdsvdwfldfarvcfeeldgivdsw
    ithnepwcagflsyhlgqhapghtdmneavravhhmllshgkavemlkgefnsatpigit
    lnlapkyaktdsindqiamnnadgyanrwfldpifkgqypvdmmnlfskyvhtydfihag
    dlatistpcdffginfysrnlvefsaasdflhkdaysdydktgmgwdiapsefkdlirrl
    raeytdlpiyitengaafddqlvdgkihdqnridyvaqhlqavsdlndegmniagyylws
    lldnfewsfgydkrfgiiyvdfdtqeriwkdsahwyanviqthkaalpqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dt7A (A:)
    fapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfeedi
    qhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdlpm
    waheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapghtd
    mneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnadgy
    anrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlvefs
    aasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlvdg
    kihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfdtq
    eriwkdsahwyanviqthkaalpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dt7B (B:)
    mgsshhhhhhssglvprgshmasmkfapnfvfgtatssyqiegahdeggrtpsiwdtfcd
    tdgkvfekhngdvacdhyhrfeediqhikqlgvdtyrfsiawprifpskgqfnpegmafy
    ktlatrlqeegikpavtlyhwdlpmwaheeggwvnrdsvdwfldfarvcfeeldgivdsw
    ithnepwcagflsyhlgqhapghtdmneavravhhmllshgkavemlkgefnsatpigit
    lnlapkyaktdsindqiamnnadgyanrwfldpifkgqypvdmmnlfskyvhtydfihag
    dlatistpcdffginfysrnlvefsaasdflhkdaysdydktgmgwdiapsefkdlirrl
    raeytdlpiyitengaafddqlvdgkihdqnridyvaqhlqavsdlndegmniagyylws
    lldnfewsfgydkrfgiiyvdfdtqeriwkdsahwyanviqthkaalpqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dt7B (B:)
    mkfapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfee
    diqhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdl
    pmwaheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapgh
    tdmneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnad
    gyanrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlve
    fsaasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlv
    dgkihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfd
    tqeriwkdsahwyanviqthka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dt7C (C:)
    mgsshhhhhhssglvprgshmasmkfapnfvfgtatssyqiegahdeggrtpsiwdtfcd
    tdgkvfekhngdvacdhyhrfeediqhikqlgvdtyrfsiawprifpskgqfnpegmafy
    ktlatrlqeegikpavtlyhwdlpmwaheeggwvnrdsvdwfldfarvcfeeldgivdsw
    ithnepwcagflsyhlgqhapghtdmneavravhhmllshgkavemlkgefnsatpigit
    lnlapkyaktdsindqiamnnadgyanrwfldpifkgqypvdmmnlfskyvhtydfihag
    dlatistpcdffginfysrnlvefsaasdflhkdaysdydktgmgwdiapsefkdlirrl
    raeytdlpiyitengaafddqlvdgkihdqnridyvaqhlqavsdlndegmniagyylws
    lldnfewsfgydkrfgiiyvdfdtqeriwkdsahwyanviqthkaalpqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dt7C (C:)
    mkfapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfee
    diqhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdl
    pmwaheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapgh
    tdmneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnad
    gyanrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlve
    fsaasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlv
    dgkihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfd
    tqeriwkdsahwyanviqthkaalp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dt7D (D:)
    mgsshhhhhhssglvprgshmasmkfapnfvfgtatssyqiegahdeggrtpsiwdtfcd
    tdgkvfekhngdvacdhyhrfeediqhikqlgvdtyrfsiawprifpskgqfnpegmafy
    ktlatrlqeegikpavtlyhwdlpmwaheeggwvnrdsvdwfldfarvcfeeldgivdsw
    ithnepwcagflsyhlgqhapghtdmneavravhhmllshgkavemlkgefnsatpigit
    lnlapkyaktdsindqiamnnadgyanrwfldpifkgqypvdmmnlfskyvhtydfihag
    dlatistpcdffginfysrnlvefsaasdflhkdaysdydktgmgwdiapsefkdlirrl
    raeytdlpiyitengaafddqlvdgkihdqnridyvaqhlqavsdlndegmniagyylws
    lldnfewsfgydkrfgiiyvdfdtqeriwkdsahwyanviqthkaalpqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dt7D (D:)
    mkfapnfvfgtatssyqiegahdeggrtpsiwdtfcdtdgkvfekhngdvacdhyhrfee
    diqhikqlgvdtyrfsiawprifpskgqfnpegmafyktlatrlqeegikpavtlyhwdl
    pmwaheeggwvnrdsvdwfldfarvcfeeldgivdswithnepwcagflsyhlgqhapgh
    tdmneavravhhmllshgkavemlkgefnsatpigitlnlapkyaktdsindqiamnnad
    gyanrwfldpifkgqypvdmmnlfskyvhtydfihagdlatistpcdffginfysrnlve
    fsaasdflhkdaysdydktgmgwdiapsefkdlirrlraeytdlpiyitengaafddqlv
    dgkihdqnridyvaqhlqavsdlndegmniagyylwslldnfewsfgydkrfgiiyvdfd
    tqeriwkdsahwyanviqthkaalp