PDB entry 5dsz

View 5dsz on RCSB PDB site
Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus
Class: translation
Keywords: translation, gamma-subunit, archaea, factor of initiation translation
Deposited on 2015-09-17, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dsza1, d5dsza2, d5dsza3
  • Chain 'B':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dszb1, d5dszb2, d5dszb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dszA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dszA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidamatmlsgaalmdgailvvaanepfpqp
    qtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalh
    kinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglf
    kvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltk
    adnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttl
    givtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dszB (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dszB (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtkrgmtiklgyaetnigvcesckkpeay
    vtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpq
    trehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhk
    inidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfk
    vdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltka
    dnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlg
    ivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei