PDB entry 5dss

View 5dss on RCSB PDB site
Description: MP-4 contributes to snake venom neutralization by Mucuna pruriens seeds through stimulation of cross-reactive antibodies
Class: plant protein
Keywords: Plant protein, Protease inhibitor, Echis carinatus (Saw-scale viper), MP-4
Deposited on 2015-09-17, released 2016-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: mp-4
  Species: Mucuna pruriens [TaxId:157652]
  Database cross-references and differences (RAF-indexed):
  • PDB 5DSS (0-184)
  Domains in SCOPe 2.06: d5dssb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dssB (B:)
  kndaepvidtdgnpllhrgkyyimpsnwgppggglrlgktrnlncpvtvlqdyneaingl
  pvkfnireilprtiftdtelnieftekpncaenrawslfkgddrghkarvgiggsnghpg
  gemlrggfygeqhglrngtyklvfcrdgsstcldvgrygnregrrlglseagelgvgfek
  agggn