PDB entry 5drp

View 5drp on RCSB PDB site
Description: Structure of the AaLpxC/LPC-023 Complex
Class: hydrolase/hydrolase inhibitor
Keywords: LpxC, Inhibitor, Lipid A, Gram-negative bacteria, hydrolase-hydrolase inhibitor complex
Deposited on 2015-09-16, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: lpxC, envA, aq_1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered mutation (180)
    Domains in SCOPe 2.07: d5drpa1, d5drpa2
  • Chain 'B':
    Compound: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: lpxC, envA, aq_1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered mutation (180)
    Domains in SCOPe 2.07: d5drpb1, d5drpb2
  • Heterogens: ZN, 5EP, CL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5drpA (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5drpA (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5drpB (B:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5drpB (B:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqk