PDB entry 5drb

View 5drb on RCSB PDB site
Description: Crystal structure of WNK1 in complex with WNK463
Class: transferase/transferase inhibitor
Keywords: kinase, inhibitor, complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-09-15, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Wnk1, Hsn2, Prkwnk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIH7
      • engineered mutation (189)
    Domains in SCOPe 2.07: d5drba_
  • Heterogens: 5FJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5drbA (A:)
    gqeernqqqddieeletkavgmsndgrflkfdieigrgsfktvykgldtettvevawcel
    qdrkltkserqrfkeeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlkty
    lkrfkvmkikvlrswcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlgla
    tlkrasfakavigtpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiy
    rrvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnhaffqeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >5drbA (A:)
    tkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkee
    aemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswc
    rqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpe
    fmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkva
    ipevkeiiegcirqnkderysikdllnhaffqe