PDB entry 5dr2

View 5dr2 on RCSB PDB site
Description: Aurora A Kinase in Complex with AA30 and ATP in Space Group P6122
Class: transferase
Keywords: Aurora A kinase, mitotic kinase, PPI, transferase
Deposited on 2015-09-15, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (4-266)
      • expression tag (3)
      • engineered mutation (163)
    Domains in SCOPe 2.06: d5dr2a1, d5dr2a2
  • Heterogens: 5E1, MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dr2A (A:)
    mgrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrratlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dr2A (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapssrratlcgtldylppemiegrmh
    dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
    npsqrpmlrevlehpwitansskp