PDB entry 5dql

View 5dql on RCSB PDB site
Description: Crystal Structure of 2-vinyl glyoxylate modified isocitrate lyase from Mycobacterium tuberculosis
Class: lyase/lyase inhibitor
Keywords: LYASE-LYASE INHIBITOR complex
Deposited on 2015-09-14, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate lyase 1
    Species: Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) [TaxId:652616]
    Gene: icl1, ERDMAN_0512, Q643_00485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dqla_
  • Chain 'B':
    Compound: Isocitrate lyase 1
    Species: Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) [TaxId:652616]
    Gene: icl1, ERDMAN_0512, Q643_00485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dqlb_
  • Chain 'C':
    Compound: Isocitrate lyase 1
    Species: Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) [TaxId:652616]
    Gene: icl1, ERDMAN_0512, Q643_00485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dqlc_
  • Chain 'D':
    Compound: Isocitrate lyase 1
    Species: Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) [TaxId:652616]
    Gene: icl1, ERDMAN_0512, Q643_00485
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dqld_
  • Heterogens: MG, VGX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dqlA (A:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dqlA (A:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dqlB (B:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dqlB (B:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dqlC (C:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dqlC (C:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dqlD (D:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dqlD (D:)
    msvvgtpksaeqiqqewdtnprwkdvtrtysaedvvalqgsvveehtlarrgaevlweql
    hdlewvnalgaltgnmavqqvraglkaiylsgwqvagdanlsghtypdqslypansvpqv
    vrrinnalqradqiakiegdtsvenwlapivadgeagfggalnvyelqkaliaagvagsh
    wedqlasekkcghlggkvliptqqhirtltsarlaadvadvptvviartdaeaatlitsd
    vderdqpfitgertregfyrtkngiepciarakayapfadliwmetgtpdleaarqfsea
    vkaeypdqmlayncspsfnwkkhlddatiakfqkelaamgfkfqfitlagfhalnysmfd
    laygyaqnqmsayvelqerefaaeergytatkhqrevgagyfdriattvdpnssttaltg
    steegqf