PDB entry 5dqf

View 5dqf on RCSB PDB site
Description: Horse Serum Albumin (ESA) in complex with Cetirizine
Class: transport protein
Keywords: albumin, cetirizine, ESA, NYSGRC, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, TRANSPORT PROTEIN
Deposited on 2015-09-14, released 2015-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (0-579)
      • engineered mutation (556)
    Domains in SCOPe 2.06: d5dqfa1, d5dqfa2, d5dqfa3
  • Heterogens: PG4, SO4, LCR, CZE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dqfA (A:)
    kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
    kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
    aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
    lkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhke
    cchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpa
    laadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaea
    dppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlv
    eigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaer
    rpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeql
    ktvlgnfsafvakccgaedkeacfaeegpklvassqlala