PDB entry 5dpx

View 5dpx on RCSB PDB site
Description: 1,2,4-Triazole-3-thione compounds as inhibitors of L1, di-zinc metallo-beta-lactamases.
Class: hydrolase
Keywords: hydrolase, metallo, zn, lactamase
Deposited on 2015-09-14, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase L1 type 3
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dpxa_
  • Chain 'B':
    Compound: Metallo-beta-lactamase L1 type 3
    Species: Stenotrophomonas maltophilia [TaxId:40324]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dpxb_
  • Heterogens: ZN, L3B, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dpxA (A:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dpxA (A:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dpxB (B:)
    aevplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqma
    shlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsd
    dlhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvri
    ayadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagarag
    akaltckayadaaeqkfdgqlaketagar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dpxB (B:)
    evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
    hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
    lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
    yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
    kaltckayadaaeqkfdgqlaketag