PDB entry 5do8

View 5do8 on RCSB PDB site
Description: 1.8 Angstrom crystal structure of Listeria monocytogenes Lmo0184 alpha-1,6-glucosidase
Class: hydrolase
Keywords: Glycoside Hydrolase Family 13, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE
Deposited on 2015-09-10, released 2015-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmo0184 protein
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo0184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YAE6 (Start-552)
      • expression tag (553)
    Domains in SCOPe 2.06: d5do8a1, d5do8a2, d5do8a3
  • Chain 'B':
    Compound: Lmo0184 protein
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo0184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YAE6 (Start-552)
      • expression tag (553-554)
    Domains in SCOPe 2.06: d5do8b1, d5do8b2, d5do8b3
  • Chain 'C':
    Compound: Lmo0184 protein
    Species: Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) [TaxId:169963]
    Gene: lmo0184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YAE6 (Start-552)
      • expression tag (553)
    Domains in SCOPe 2.06: d5do8c1, d5do8c2, d5do8c3
  • Heterogens: BGC, CL, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5do8A (A:)
    mkekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqd
    dngydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskd
    npyrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvy
    nmmkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemn
    qevtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiyl
    pdlkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgt
    pyiyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpy
    qwdnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgny
    rlllpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniieg
    tlrpyeaivyqikga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5do8A (A:)
    ekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqddn
    gydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskdnp
    yrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvynm
    mkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemnqe
    vtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiylpd
    lkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgtpy
    iyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpyqw
    dnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgnyrl
    llpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniiegtl
    rpyeaivyqikg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5do8B (B:)
    mkekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqd
    dngydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskd
    npyrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvy
    nmmkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemn
    qevtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiyl
    pdlkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgt
    pyiyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpy
    qwdnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgny
    rlllpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniieg
    tlrpyeaivyqikga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5do8B (B:)
    ekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqddn
    gydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskdnp
    yrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvynm
    mkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemnqe
    vtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiylpd
    lkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgtpy
    iyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpyqw
    dnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgnyrl
    llpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniiegtl
    rpyeaivyqikga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5do8C (C:)
    mkekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqd
    dngydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskd
    npyrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvy
    nmmkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemn
    qevtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiyl
    pdlkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgt
    pyiyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpy
    qwdnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgny
    rlllpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniieg
    tlrpyeaivyqikga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5do8C (C:)
    kdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqddng
    ydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskdnpy
    rdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvynmm
    kfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemnqev
    tskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiylpdl
    kenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgtpyi
    yqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpyqwd
    nsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiittgnyrll
    lpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpniiegtlr
    pyeaivyqikg