PDB entry 5dnf

View 5dnf on RCSB PDB site
Description: Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin
Class: cytokine
Keywords: CC chemokine, high oligomer, CYTOKINE
Deposited on 2015-09-10, released 2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfa_
  • Chain 'B':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfb_
  • Chain 'C':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfc_
  • Chain 'D':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfd_
  • Chain 'E':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfe_
  • Chain 'F':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnff_
  • Chain 'G':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfg_
  • Chain 'H':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfh_
  • Chain 'I':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dnfi_
  • Heterogens: GLA, BGC, SO4, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfA (A:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfB (B:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfC (C:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfD (D:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfE (E:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfF (F:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfG (G:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfH (H:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5dnfI (I:)
ssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyin
slems