PDB entry 5dmk

View 5dmk on RCSB PDB site
Description: Crystal Structure of IAg7 in complex with RLGL-WE14
Class: immune system
Keywords: Chromogranin A, Type I Diabetes, T cell, fusion protein, IMMUNE SYSTEM
Deposited on 2015-09-08, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: I-Ag7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dmka1, d5dmka2
  • Chain 'B':
    Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMK (0-End)
    • Uniprot Q31135 (27-211)
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: I-Ag7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dmkc1, d5dmkc2
  • Chain 'D':
    Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMK (0-End)
    • Uniprot Q31135 (27-211)
  • Chain 'E':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: I-Ag7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dmke1, d5dmke2
  • Chain 'F':
    Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMK (0-End)
    • Uniprot Q31135 (27-211)
  • Chain 'G':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: I-Ag7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dmkg1, d5dmkg2
  • Chain 'H':
    Compound: beta chain of Major Histocompatibility Complex Class II, I-Ag7,H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 5DMK (0-End)
    • Uniprot Q31135 (27-End)
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dmkA (A:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dmkA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dmkC (C:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dmkE (E:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dmkG (G:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgle
    

  • Chain 'H':
    No sequence available.