PDB entry 5dmb

View 5dmb on RCSB PDB site
Description: Crystal structure of a translational regulator bound to a flagellar assembly factor
Class: translation
Keywords: Translation, flagellum, assembly factor
Deposited on 2015-09-08, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar assembly factor FliW
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Gene: fliW, GTNG_3059
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ISV0
      • conflict (38)
  • Chain 'D':
    Compound: carbon storage regulator homolog
    Species: Geobacillus thermodenitrificans [TaxId:33940]
    Gene: csrA, GTNG_3058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dmbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dmbD (D:)
    mglvltrklkeaiqigddieitvlaiqgdqvklginapkhveihrkeiylaiqaennaas
    hasksslkrlneqlkhlkggkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dmbD (D:)
    lvltrklkeaiqigddieitvlaiqgdqvklginapkhveihrkeiylaiqaennaasha
    sksslkrlneql