PDB entry 5dl1

View 5dl1 on RCSB PDB site
Description: ClpP from Staphylococcus aureus in complex with AV145
Class: hydrolase
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex, caseinolytic protease, allosteric regulation, binding analysis, hydrolase
Deposited on 2015-09-04, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAB0722
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dl1n_
  • Heterogens: 5C2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dl1A (A:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1A (A:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dl1B (B:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1B (B:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5dl1C (C:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1C (C:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5dl1D (D:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1D (D:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5dl1E (E:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1E (E:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5dl1F (F:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1F (F:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5dl1G (G:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1G (G:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5dl1H (H:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1H (H:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5dl1I (I:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1I (I:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5dl1J (J:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1J (J:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5dl1K (K:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1K (K:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5dl1L (L:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1L (L:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5dl1M (M:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1M (M:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5dl1N (N:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylyinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dl1N (N:)
    liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
    spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
    lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
    idevmvpe