PDB entry 5dkc

View 5dkc on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRM (SMARCA2) in complex with PFI-3 chemical probe
Class: hydrolase
Keywords: SWI-SNF complex, chromatin remodeling, Brg associated factors (BAF), transcription, hydrolase
Deposited on 2015-09-03, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable global transcription activator SNF2L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA2, BAF190B, BRM, SNF2A, SNF2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dkca_
  • Heterogens: ZN, 5BW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5dkcA (A:)
smaeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvd
fkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
eee

    Sequence, based on observed residues (ATOM records): (download) 
    >5dkcA (A:)
pkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkikerirn
hkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak