PDB entry 5dju
View 5dju on RCSB PDB site
Description: Crystal structure of LOV2 (C450A) domain in complex with Zdk3
Class: signaling protein
Keywords: Protein binding, Protein engineering, Signaling protein, Photoswitch, Light-induced signal transduction, LOV2, Affibody, Complex
Deposited on
2015-09-02, released
2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2016-09-07, with a file datestamp of
2016-09-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: nph1-2
Species: AVENA SATIVA [TaxId:4498]
Gene: NPH1-2
Database cross-references and differences (RAF-indexed):
- Uniprot O49004 (2-144)
- expression tag (0-1)
- engineered mutation (48)
- Chain 'B':
Compound: Engineered protein, Zdk3 affibody
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5djub_ - Chain 'C':
Compound: nph1-2
Species: AVENA SATIVA [TaxId:4498]
Gene: NPH1-2
Database cross-references and differences (RAF-indexed):
- Uniprot O49004 (2-144)
- expression tag (0-1)
- engineered mutation (48)
- Chain 'D':
Compound: Engineered protein, Zdk3 affibody
Species: Staphylococcus aureus [TaxId:1280]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d5djud_ - Heterogens: FMN, CL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>5djuB (B:)
ggsvdnkfnkevlvarqeiywlpnlnweqkfafissltndpsqsanllaeakklngaqpp
k
Sequence, based on observed residues (ATOM records): (download)
>5djuB (B:)
nkfnkevlvarqeiywlpnlnweqkfafissltndpsqsanllaeakklngaqpp
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>5djuD (D:)
ggsvdnkfnkevlvarqeiywlpnlnweqkfafissltndpsqsanllaeakklngaqpp
k
Sequence, based on observed residues (ATOM records): (download)
>5djuD (D:)
nkfnkevlvarqeiywlpnlnweqkfafissltndpsqsanllaeakklngaqpp