PDB entry 5djt

View 5djt on RCSB PDB site
Description: Crystal structure of LOV2 (C450A) domain in complex with Zdk2
Class: signaling protein
Keywords: Protein binding, Protein engineering, Signaling protein, Photoswitch, Light-induced signal transduction, LOV2, Affibody, Complex
Deposited on 2015-09-02, released 2016-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nph1-2
    Species: AVENA SATIVA [TaxId:4498]
    Gene: NPH1-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O49004 (2-144)
      • expression tag (1)
      • conflict (48)
  • Chain 'B':
    Compound: Engineered protein, Zdk2 affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 5DJT (Start-60)
    Domains in SCOPe 2.08: d5djtb_
  • Heterogens: CU, FMN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5djtB (B:)
ggsvdnkfnkemlsarveiyglpnlnwgqrfafissltddpsqsanllaeakklndaqap
k

    Sequence, based on observed residues (ATOM records): (download) 
    >5djtB (B:)
svdnkfnkemlsarveiyglpnlnwgqrfafissltddpsqsanllaeakklndaqapk