PDB entry 5dj9

View 5dj9 on RCSB PDB site
Description: Crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49 in a complex with gabaculine
Class: transferase
Keywords: inhibitor, complex, parasite, PYRIDOXAL 5'-PHOSPHATE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-09-01, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dj9a_
  • Chain 'B':
    Compound: Ornithine aminotransferase, mitochondrial
    Species: Toxoplasma gondii ME49 [TaxId:508771]
    Gene: TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dj9b_
  • Heterogens: SO4, BTB, PXG, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dj9A (A:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dj9A (A:)
    ktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflag
    vsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgae
    agesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgf
    elidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivde
    iqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfg
    gnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnave
    vdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveee
    r
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dj9B (B:)
    matksdgsasaaaeggarktnieayrdglklkteedffacdrqyvcqnyapvpvviskgk
    garvwdingneyydflagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrf
    maemfgydrvllmntgaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacs
    ssttfdcynnfgpftpgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgyl
    krahelcrsknvllivdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmg
    radvmdvlkpgthgstfggnplacavavealtvlkdekladraerlgaqfrdclrrelyg
    kvpwikeirgrgllnavevdsdaidpndvvmklkengilskptrgrvmrfipplvitdee
    hrdattriiksflaveeerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dj9B (B:)
    tnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydflagv
    sslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntgaea
    gesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpgfe
    lidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivdei
    qtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstfgg
    nplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnavev
    dsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflaveeer
    k