PDB entry 5dh9

View 5dh9 on RCSB PDB site
Description: Crystal Structure of PKI NES Flip Mutant Peptide in complex with CRM1-Ran-RanBP1
Class: transport protein
Keywords: Peptides, HEAT repeat, Nuclear Export signal, Exportin-1, Nuclear Transport, TRANSPORT PROTEIN
Deposited on 2015-08-30, released 2015-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dh9a_
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YRB1, CST20, HTN1, SFO1, YDR002W, YD8119.08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dh9b_
  • Chain 'C':
    Compound: Exportin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CRM1, KAP124, XPO1, YGR218W, G8514
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (3-End)
      • expression tag (2)
      • engineered mutation (502)
      • engineered mutation (504-506)
      • engineered mutation (987)
  • Chain 'D':
    Compound: Engineered Nuclear Export Signal Peptide (PKINES-Flip3 mutant)
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkia
    Database cross-references and differences (RAF-indexed):
    • PDB 5DH9
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dh9A (A:)
    metgsshhhhhhssglprgshmaaqgepqvqfklvlvgdggtgkttfvkrhltgefekky
    vatlgvevhplvfhtnrgpikfnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyk
    nvpnwhrdlvrvcenipivlcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfek
    pflwlarkligdpnlefvampalappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dh9A (A:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappedp
    alaaqyehdlevaqttalpdedddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dh9B (B:)
    ggsdihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkk
    tnkvrilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairf
    gskenadkfkeefekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dh9B (B:)
    hfepvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktl
    kicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefe
    kaqeinkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.