PDB entry 5dgu

View 5dgu on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Inhibitors Containing Substituted fused-Tetrahydropyranyl Tetrahydrofuran as P2-Ligand GRL-004-11A
Class: hydrolase
Keywords: HIV-1 Protease, Enzyme, Hydrolase, Hydrolase inhibitor
Deposited on 2015-08-28, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Q3H0 (0-98)
    • conflict (6)
    • conflict (32)
    • conflict (62)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.08: d5dgua_
• Chain 'B':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Q3H0 (0-98)
    • conflict (6)
    • conflict (32)
    • conflict (62)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.08: d5dgub_
• Heterogens: 5B7, NA, CL, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dguA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5dguB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf