PDB entry 5dgt

View 5dgt on RCSB PDB site
Description: BENZOYLFORMATE DECARBOXYLASE H70A MUTANT at pH 8.5 FROM PSEUDOMONAS PUTIDA
Class: lyase
Keywords: benzoylformate decarboxylase thiamin thiazolone diphosphate, lyase
Deposited on 2015-08-28, released 2015-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-523)
      • engineered mutation (68)
    Domains in SCOPe 2.05: d5dgta1, d5dgta2, d5dgta3
  • Heterogens: MG, CA, TZD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5dgtA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlasaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvs