PDB entry 5dg5

View 5dg5 on RCSB PDB site
Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with altiratinib analog dp-4157
Class: transferase/transferase inhibitor
Keywords: TYROSINE KINASE DOMAIN, HEPATOCYTE GROWTH FACTOR RECEPTOR C-MET, C-MET, ALTIRATINIB ANALOG, DP-4157, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-08-27, released 2016-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dg5a_
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5dg5b_
  • Heterogens: 5B4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dg5A (A:)
    mghhhhhhmgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrgh
    fgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclr
    segsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaar
    ncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvws
    fgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrp
    sfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dg5A (A:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dg5B (B:)
    mghhhhhhmgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrgh
    fgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclr
    segsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaar
    ncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvws
    fgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrp
    sfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dg5B (B:)
    tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig