PDB entry 5dg2

View 5dg2 on RCSB PDB site
Description: Sugar binding protein - human galectin-2 (dimer)
Class: sugar binding protein
Keywords: human galectin-2, SUGAR BINDING PROTEIN
Deposited on 2015-08-27, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dg2a_
  • Chain 'B':
    Compound: galectin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5dg2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dg2A (A:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dg2A (A:)
    elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
    nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
    nmssfklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dg2B (B:)
    gshmtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivc
    nsldgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsyl
    svrggfnmssfklke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dg2B (B:)
    mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
    dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
    ggfnmssfklk