PDB entry 5dfs

View 5dfs on RCSB PDB site
Description: Crystal structure of Spider Monkey Cytochrome C at 1.15 Angstrom
Class: electron transport
Keywords: Mitochondrial cytochrome c, ELECTRON TRANSPORT
Deposited on 2015-08-27, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Ateles sp. [TaxId:9511]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dfsa_
  • Chain 'B':
    Compound: cytochrome c
    Species: Ateles sp. [TaxId:9511]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5dfsb_
  • Heterogens: HEM, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dfsA (A:)
    mgdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiw
    gedtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dfsA (A:)
    gdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5dfsB (B:)
    mgdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiw
    gedtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dfsB (B:)
    gdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiwg
    edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne