PDB entry 5dfr

View 5dfr on RCSB PDB site
Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding
Class: oxidoreductase
Keywords: oxido-reductase, oxidoreductase
Deposited on 1988-10-21, released 1990-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.07: d5dfra_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dfrA (A:)
    misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dfrA (A:)
    misliaalavdrvigpwnlpadlawfkrntldkpvimgrhtwesigrplpgrkniilssq
    pgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaevegdthf
    pdyepddwesvfsefhdadaqnshsycfeilerr