PDB entry 5dfc

View 5dfc on RCSB PDB site
Description: Crystal structure of BRD2(BD2) W370F mutant with ligand I-BET 762 bound
Class: transcription
Keywords: Transcription factors, BET bromodomains, protein mutation engineering, molecular probes, transcription
Deposited on 2015-08-26, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5dfca_
  • Heterogens: GOL, 2PE, EAM, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5dfcA (A:)
    smgklseqlkhcngilkellskkhaayafpfykpvdasalglhdyhdiikhpmdlstvkr
    kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5dfcA (A:)
    lseqlkhcngilkellskkhaayafpfykpvdasalglhdyhdiikhpmdlstvkrkmen
    rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp