PDB entry 5dfb
View 5dfb on RCSB PDB site
Description: Crystal structure of BRD2(BD2) mutant W370F in the free form
Class: transcription
Keywords: Transcription factors, BET bromodomains, protein mutation engineering, molecular probes, transcription
Deposited on
2015-08-26, released
2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated
2015-11-11, with a file datestamp of
2015-11-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain-containing protein 2
Species: Homo sapiens [TaxId:9606]
Gene: BRD2, KIAA9001, RING3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d5dfba_ - Heterogens: NI, 2PE, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5dfbA (A:)
smgklseqlkhcngilkellskkhaayafpfykpvdasalglhdyhdiikhpmdlstvkr
kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
Sequence, based on observed residues (ATOM records): (download)
>5dfbA (A:)
seqlkhcngilkellskkhaayafpfykpvdasalglhdyhdiikhpmdlstvkrkmenr
dyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmp