PDB entry 5df5

View 5df5 on RCSB PDB site
Description: The structure of oxidized rat cytochrome c (T28E) at 1.30 angstroms resolution.
Class: electron transport
Keywords: cytochrome c, oxidized, rat, mutant, electron transport
Deposited on 2015-08-26, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c, somatic
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cycs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62898 (0-103)
      • conflict (27)
    Domains in SCOPe 2.08: d5df5a_
  • Chain 'B':
    Compound: Cytochrome c, somatic
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cycs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62898 (0-103)
      • conflict (27)
    Domains in SCOPe 2.08: d5df5b_
  • Chain 'C':
    Compound: Cytochrome c, somatic
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cycs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62898 (0-103)
      • conflict (27)
    Domains in SCOPe 2.08: d5df5c_
  • Chain 'D':
    Compound: Cytochrome c, somatic
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Cycs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62898 (0-103)
      • conflict (27)
    Domains in SCOPe 2.08: d5df5d_
  • Heterogens: HEC, FC6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5df5A (A:)
gdvekgkkifvqkcaqchtvekggkhkegpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5df5B (B:)
gdvekgkkifvqkcaqchtvekggkhkegpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5df5C (C:)
gdvekgkkifvqkcaqchtvekggkhkegpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5df5D (D:)
gdvekgkkifvqkcaqchtvekggkhkegpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne