PDB entry 5deq

View 5deq on RCSB PDB site
Description: Crystal structure of transcriptional factor AraR from Bacteroides thetaiotaomicron VPI in complex with L-arabinose
Class: transcription regulator
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION REGULATOR
Deposited on 2015-08-25, released 2015-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5deqa1, d5deqa2
  • Chain 'B':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5deqb1, d5deqb2
  • Heterogens: ARA, SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5deqA (A:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5deqA (A:)
    mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa
    krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn
    inelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdkr
    nfrkrvaemdfiektdkidkrgaalykfngkayr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5deqB (B:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5deqB (B:)
    nyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakr
    vlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvnin
    elpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdkrnf
    rkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl