PDB entry 5dep

View 5dep on RCSB PDB site
Description: Structure of Pseudomonas aeruginosa LpxA in complex with UDP-GlcNAc
Class: transferase
Keywords: Acyltransferase Catalytic Domain, Fatty Acids, Lipid A, Substrate Specificity, Uridine Diphosphate N-Acetylglucosamine, Hydrocarbon Rulers, TRANSFERASE
Deposited on 2015-08-25, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depa_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depb_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depc_
  • Chain 'D':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depd_
  • Chain 'E':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depe_
  • Chain 'F':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: lpxA, PSPA7_1495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5depf_
  • Heterogens: PO4, UD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5depA (A:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5depB (B:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5depB (B:)
    slidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqf
    ssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahigh
    dsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayv
    tvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpe
    vavfrdsiqsatrgitr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5depC (C:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5depC (C:)
    lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs
    svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd
    svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt
    vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev
    avfrdsiqsatrgitr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5depD (D:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5depE (E:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5depE (E:)
    slidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqf
    ssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahigh
    dsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayv
    tvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpe
    vavfrdsiqsatrgitr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5depF (F:)
    mslidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyq
    fssvgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahig
    hdsvignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpay
    vtvfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfp
    evavfrdsiqsatrgitr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5depF (F:)
    lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs
    svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd
    svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt
    vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev
    avfrdsiqsatrgitr